PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462939486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 436aa    MW: 46514.5 Da    PI: 7.5787
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462939486genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.16.7e-184633899
               EEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
         B3 38 ledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                +d +g +W++++iyr++++r++lt+GW++Fv++++L +gD++vF +   ++++ +v+++r+
  462939486  4 ARDVHGVEWKFRHIYRGTPRRHLLTTGWSNFVNQKKLLAGDSIVFLR--GQDGQVHVGLRRA 63
               6899******************************************3..378888***9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.06E-13162No hitNo description
SMARTSM010190.0097164IPR003340B3 DNA binding domain
PROSITE profilePS5086313.352164IPR003340B3 DNA binding domain
SuperFamilySSF1019362.88E-16264IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.7E-21266IPR015300DNA-binding pseudobarrel domain
PfamPF023622.0E-15363IPR003340B3 DNA binding domain
PROSITE profilePS5174516.588348428IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
NVFARDVHGV EWKFRHIYRG TPRRHLLTTG WSNFVNQKKL LAGDSIVFLR GQDGQVHVGL  60
RRAKRGHGPG PGDDSSSVSG WDPYRGLVRG GNAATSSPSG KVTWDEPELL QNVKRVCPWL  120
VELVSSMPNL HLPSAADFPP FDGQLFDPAS FPLLHQDRKH HHGGFAPSFF PFPDGSAAAG  180
IQGARQAQFA PSFSDLHISN LQQQHHGLLF SSSSGIRNLL PADHPHRAPR ISTDLTIGGG  240
LSSGGKKPDD DVKPPPPPPG IVLFGRTILT EEQIKSTTTT TNSSSGGRTS PRGSSKSDSD  300
ADKAAPNTSS GSGSGSGVIQ GSPTASWRLQ WSSADNGSQS SSEFGLEPGQ CKVFVESDAV  360
GRNLDLAALG SFEELFARLS DMFGIDDAEL RSHVLYRTNS GEVKHAGDEP FSAFVKSARR  420
ITILTDAGSD NIGSSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A3e-20177163239Auxin response factor 1
4ldy_B3e-20177163239Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452482.11e-101hypothetical protein SORBIDRAFT_04g026610
SwissprotQ6K2231e-101ARFH_ORYSJ; Auxin response factor 8
TrEMBLA0A0A9IN851e-137A0A0A9IN85_ARUDO; Uncharacterized protein
STRINGMLOC_67174.11e-106(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51637152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30080.15e-32auxin response factor 16